GLP-1 DERIVATIVES Russian patent published in 2003 - IPC

FIELD: biologically active peptides. SUBSTANCE: invention relates to derivatives of parent peptide GLP-1 having one or twp lipophilic substituents optionally connected to amino acid residue via amino acid or dipeptide spacer, said amino acid residue being no N-terminal or N- terminal amino acid residue and said parent peptide having following amino acid sequence: HAEGTFTSDVSSYLEGQAAKEEFIAWLVKGRG or having up to 1- amino acid residues in sum specified by any genetically encoded alpha-amino acid residue. Pharmaceutical compositions containing indicated derivatives as well as utilization thereof for preparing drug with prolonged obesity-treating activity are likewise described. EFFECT: prolonged activity profile with regard to GLP-1 (7-37). 74 cl, 2 tbl, 45 ex