METHODS AND PHARMACEUTICAL COMPOSITIONS FOR TREATMENT OF KIDNEY CANCER Russian patent published in 2021 - IPC A61K38/17 A61K31/7088 A61P35/00 C07K14/47 C12N15/00 

FIELD: medicine; pharmaceutics.

SUBSTANCE: group of inventions relates to the field of medicine and pharmaceutics, namely to the use of ELA polypeptide and nucleic acid encoding it, wherein ELA polypeptide contains amino acid sequence having at least 90% identity with SEQ ID NO: 1 (QRPVNLTMRRKLRKHNCLQRRCMPLHSRVPFP), wherein the arginine residue (R) in positions 9, 10, 20 or 21 is replaced, if needed, with the alanine residue (A) and/or the serine residue (S) for the treatment of kidney cancer; and to the use of ELA polypeptide or nucleic acid encoding it, wherein ELA polypeptide contains SEQ ID NO: 1 (QRPVNLTMRRKLRKHNCLQRRCMPLHSRVPFP), wherein the arginine residue (R) in positions 9, 10, 20 or 21 is replaced, if needed, with the alanine residue (A) and/or the serine residue (S) for the treatment of kidney cancer.

EFFECT: group of inventions provides new effective approaches to the treatment of kidney cancer.

6 cl, 11 dwg, 2 ex