EXOGENIC-INDUCED ANIMAL MODEL OF ALZHEIMER DISEASE Russian patent published in 2014 - IPC G09B23/28 

FIELD: medicine.

SUBSTANCE: invention refers to experimental medicine and concerns modelling Alzheimer disease. That is ensured by using B6C3-Tg(APPswe,PSEN1dE9)85Dbo/J oncomice. A preparation containing a synthetic analogue of aspartic acid isomerised in an amino acid residue in position 7 of human beta-amyloid with the amino acid sequence DAEFRH[isoD]SGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA) and/or fragments thereof containing the isomerised aspartic acid residue in position 7 [isoD] into the animal's blood-vascular system. The preparations are administered in a dose of 100 mcg, in 200 mcl/head of the solution once a month.

EFFECT: method enables a spontaneous change of a rate of the pathological process progression in the test animals depending on the purposes of the specific study by varying the number of injections and/or an amount of synthetic peptide per one injectable dose.

1 dwg,1 tbl