NOVEL PEPTIDES WITH ANALGESIC EFFECT, INHIBITING ASIC-RFYFKS Russian patent published in 2016 - IPC C07K14/46 A61K38/17 C12N15/12 A61K48/00 A61K49/14 A61P29/02 

FIELD: biotechnologies.

SUBSTANCE: present invention relates to biotechnology, specifically to obtaining new recovered peptides, which cause analgesia and inhibit ASIC channels (proton-sensitive ion channels), to polynucleotides coding said peptides, as well as vectors and their application, and can be used in medicine. Above peptides allocated from poison of Dendroaspis polylepis snake and have amino acid sequence of LKCX⁴QHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK, wherein X⁴ denotes any amino acid; or sequence with similarity of at least 56 % with above sequence and preserving analgesic activity.

EFFECT: invention allows to produce peptide inhibiting ASIC channels, containing at least one subunit, selected from group consisting of subunits ASIC1a and ASIC1b.

14 cl, 7 dwg, 1 tbl, 7 ex